General Information

  • ID:  hor005713
  • Uniprot ID:  Q9I8P3
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  NPY Family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0071878 negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway; GO:2000253 positive regulation of feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MNPNMKMWMSWAACAFLLFVCLGTLTEGYPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSADTLISDLLIGETESRPQTRYEDHLAW
  • Signal peptide:  MNPNMKMWMSWAACAFLLFVCLGTLTEG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9I8P3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005713_AF2.pdbhor005713_ESM.pdb

Physical Information

Mass: 487919 Formula: C192H290N52O58
Absent amino acids: CFMVW Common amino acids: Y
pI: 7.51 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -112.22 Boman Index: -9367
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 65.28
Instability Index: 6076.11 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  10936170
  • Title:  Zebrafish Genes for Neuropeptide Y and Peptide YY Reveal Origin by Chromosome Duplication From an Ancestral Gene Linked to the Homeobox Cluster.
  • PubMed ID:  23508731
  • Title:  Interactions of Zebrafish Peptide YYb With the Neuropeptide Y-family Receptors Y4, Y7, Y8a, and Y8b